Recombinant rat GH-22K produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 22367 Dalton.
- Gene name: Growth Hormone
- Host: E. coli
- Label: None
- Applications: rGH is fully biologically active when compared to WHO reference standard using in vitro bioassay. It is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD).
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Endotoxin levels: < 0.1 ng/µg of protein (<1EU/µg)
- Reconstitution Buffer: Water, pH 9
- Additives/Stabilizer: None
- Form: lyophilized
- Reconstitution tips: It is recommended to reconstitute the lyophilized rGH in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
- MW: 22.3 kDa
- Length (aa): 192
- Protein Sequence: AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
- NCBI GeneID: 24391
- Accession Number Protein: NP_001030020.2
- Accession Numberm RNA: NM_001034848.2
- Uniprot: P01244
For research use only.
0 reviews for ReliaTech