Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. The wild type leptin was mutated at position 4 replacing arginine by cysteine. Recombinant ovine leptin R4C mutant was purified by proprietary chromatographic techniques, see Reicher et al. J. Animal Sciences 90:410-418 (2012).
- Gene name: Leptin R4C mutant
- Host: E. coli
- Label: None
- Applications: Recombinant ovine leptin R4C mutant is fully biologically active compared to the wild-type ovine leptin as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor.
- Species Reactivity/Origin species: Ovine
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Endotoxin levels: < 0.1 ng/µg of protein (<1EU/µg)
- Reconstitution Buffer: 0.4% NaHCO3, pH 8-9
- Additives/Stabilizer: None
- Form: lyophilized
- Reconstitution tips: It is recommended to reconstitute the lyophilized recombinant ovine leptin R4C mutant in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
- MW: 16.0 kDa
- Length (aa): 146
- Protein Sequence: AVPCRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
- NCBI GeneID: 443534
- Accession Number Protein: XP_027824581.2
- Accession Numberm RNA: XM_027968780.2
For research use only.
0 reviews for ReliaTech