RNASET2, also known as RNASE6PL, is short for bonuclease T2. It is a 256 aa. protein which belongs to the RNase T2 family. RNASET2 is a secreted protein, and is higher expressed in the temporal lobe and fetal brain. This protein can be inhibited by Zn2+ and Cu2+. It has ribonuclease activity, with higher activity at acidic pH and is probably involved in lysosomal degradation of ribosomal RNA. It also plays a role in cellular RNA catabolism.
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
- Tested Applications: N/A
- Applications: This recombinant protein can be used for biological assays. For research use only.
- Predicted Molecular Weight: 28.2 kD
- Physical state: Liquid
- Buffer: Supplied as a 0.2 um filtered solution of 20mM TrisHcl, 150mM NaCl,20%Glycerol,pH7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
- Concentration: N/A
- NCBI official symbol: RNASET2
- Accession #: O00584
- Protein GI: N/A
- NCBI gene ID#: 8635
- NCBI official full name: ribonuclease T2
- NCBI organism: Homo sapiens
- Peptide sequence: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
- SWISSPROT #: O00584
- Background Reference 1: N/A
- Background Reference 2: N/A
- Background Reference 3: N/A
- Background Reference 4: N/A
- Background Reference 5: N/A
- Source: Human Cells
- Species: Human
- By Source: Human Cells
- By Species: Human
- Fusion tag: C-6 His tag
- Sequence: Asp25-His256
- Biology activity: N/A
- Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
0 reviews for ProSci