Recombinant Human Zymogen granule protein 16 homolog B (ZG16B)

Supplier: Gentaur

10ug: 0.01GBP
50ug: 0.01GBP
100ug: 0.01GBP
200ug: 0.01GBP
500ug: 0.01GBP
1MG: 0.01GBP
Catalog: 399-1-CSB-YP836195HU

Product Category: Business & Industrial > Science & Laboratory

You may also be interested


53-208aa



N-terminal 6xHis-tagged


Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.


GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

For research use only.

0 reviews for Cusabio

Add a review

Your email address will not be published.