Rabbit polyclonal Endoglin antibody
- Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Shipping: Blue Ice
- Category: Purified Polyclonal Antibodies
- Research Area: Cell Biology
- Immunogen: Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids GLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGG
- Host: Rabbit
- Specificity: NA
- Cross Reactivity: Human
- Isotype: NA
- Clone: NA
- Method of Purification: Total IgG Protein A purified
- Concentration: 1 mg/ml
- Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Applications: WB, IHC
- Usage Recommendations: WB: 1.25 ug/ml
- IHC: 4-8 ug/ml
0 reviews for Fitzgerald