Endoglin antibody

Supplier: Gentaur

0.01 GBP
Catalog: 91-70R-1692 Stock:On request
Product Size: 100 ug

You may also be interested


Rabbit polyclonal Endoglin antibody



  • Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
  • Shipping: Blue Ice


  • Category: Purified Polyclonal Antibodies
  • Research Area: Cell Biology
  • Immunogen: Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids GLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGG
  • Host: Rabbit
  • Specificity: NA
  • Cross Reactivity: Human
  • Isotype: NA
  • Clone: NA
  • Method of Purification: Total IgG Protein A purified
  • Concentration: 1 mg/ml
  • Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Applications: WB, IHC
  • Usage Recommendations: WB: 1.25 ug/ml
  • IHC: 4-8 ug/ml

0 reviews for Fitzgerald

Add a review

Your email address will not be published.