Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
All of the components are shipped on ice packs/blue ice. Upon receiving the kit keep it at +4 degrees Celsius for up to 1 year (refer to the label on the box for the exact expiration date).
- Reactivity: Human
- Sample types: serum, whole blood, plasma and other biological fluids
- Detection range: Please inquire
- Sensitivity: Please inquire Quantitative Sandwich ELISA
- Method of detection: Colorimetric
This kit is intended for research use only. It should not be used for human or animal clinical diagnostics or treatment.
0 reviews for Abbkine